PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000137854
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 91aa    MW: 10112.6 Da    PI: 8.3305
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000137854genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26088.77.8e-28679174
         DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvy 74
                   aCaaCk++rrkC++ C la yfpa++  +f n++++FG+sn+ k+l+++++++r+++++++++e++++ ++P  
  MDP0000137854  6 ACAACKYQRRKCTQTCELAAYFPASRFVEFVNAQHMFGMSNIEKILATVEPDQRPATAETILFEGNIWRNNPSV 79
                   7***********************************************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.814591IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-25678IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MANSKACAAC KYQRRKCTQT CELAAYFPAS RFVEFVNAQH MFGMSNIEKI LATVEPDQRP  60
ATAETILFEG NIWRNNPSVV ALVLPDSSAN K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361325.13e-63PREDICTED: LOB domain-containing protein 22-like
TrEMBLM5VSQ06e-30M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
STRINGSolyc08g065130.1.13e-19(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-22LOB domain-containing protein 22